Lineage for d6u7fb3 (6u7f B:549-636)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376781Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2376803Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2376804Protein automated matches [254707] (4 species)
    not a true protein
  7. 2376805Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2376832Domain d6u7fb3: 6u7f B:549-636 [376915]
    Other proteins in same PDB: d6u7fa1, d6u7fa2, d6u7fa4, d6u7fb1, d6u7fb2, d6u7fb4
    automated match to d4fyta3
    complexed with nag, zn

Details for d6u7fb3

PDB Entry: 6u7f (more details), 2.75 Å

PDB Description: hcov-229e rbd class iv in complex with human apn
PDB Compounds: (B:) Aminopeptidase N

SCOPe Domain Sequences for d6u7fb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u7fb3 b.1.30.0 (B:549-636) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraq
ndlfstsgnewvllnlnvtgyyrvnyde

SCOPe Domain Coordinates for d6u7fb3:

Click to download the PDB-style file with coordinates for d6u7fb3.
(The format of our PDB-style files is described here.)

Timeline for d6u7fb3: