Lineage for d6nb1d_ (6nb1 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2460964Species Escherichia coli [TaxId:83333] [376807] (5 PDB entries)
  8. 2460968Domain d6nb1d_: 6nb1 D: [376808]
    automated match to d1yg6a_
    complexed with gol, khs

Details for d6nb1d_

PDB Entry: 6nb1 (more details), 1.9 Å

PDB Description: crystal structure of escherichia coli clpp protease complexed with small molecule activator, acp1-06
PDB Compounds: (D:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6nb1d_:

Sequence, based on SEQRES records: (download)

>d6nb1d_ c.14.1.1 (D:) automated matches {Escherichia coli [TaxId: 83333]}
vpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyly
inspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmih
qplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeavey
glvdsilthrn

Sequence, based on observed residues (ATOM records): (download)

>d6nb1d_ c.14.1.1 (D:) automated matches {Escherichia coli [TaxId: 83333]}
vpmversfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggv
itagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyq
gqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsil
thrn

SCOPe Domain Coordinates for d6nb1d_:

Click to download the PDB-style file with coordinates for d6nb1d_.
(The format of our PDB-style files is described here.)

Timeline for d6nb1d_: