SCOPe 2.07: Structural Classification of Proteins

PDB entry 6nb1

View 6nb1 on RCSB PDB site
Description: Crystal structure of Escherichia coli ClpP protease complexed with small molecule activator, ACP1-06
Class: hydrolase
Keywords: Serine protease, antibiotic, HYDROLASE
Deposited on 2018-12-06, released 2019-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1a_
Chain 'B':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1b_
Chain 'C':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1c_
Chain 'D':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1d_
Chain 'E':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1e_
Chain 'F':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1f_
Chain 'G':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1g_
Chain 'H':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1h_
Chain 'I':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1i_
Chain 'J':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1j_
Chain 'K':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1k_
Chain 'L':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1l_
Chain 'M':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1m_
Chain 'N':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: clpP, lopP, b0437, JW0427
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-206)
Domains in SCOPe 2.07: d6nb1n_
Heterogens: KHS, GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6nb1A (A:)
msysgerdnfaphmalvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaq
mlfleaenpekdiylyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltag
akgkrfclpnsrvmihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqier
dterdrflsapeaveyglvdsilthrn