Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.0: automated matches [191525] (1 protein) not a true family |
Protein automated matches [190884] (7 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [255904] (9 PDB entries) |
Domain d6mwic1: 6mwi C:1-159 [376446] Other proteins in same PDB: d6mwib2, d6mwic2 automated match to d2pmpa_ complexed with act, dms, ezl, peg, zn |
PDB Entry: 6mwi (more details), 1.75 Å
SCOPe Domain Sequences for d6mwic1:
Sequence, based on SEQRES records: (download)
>d6mwic1 d.79.5.0 (C:1-159) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa dldlpldrvnvkaktneklgylgrgegieaqaaalvvre
>d6mwic1 d.79.5.0 (C:1-159) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhftdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadl dlpldrvnvkaktneklgylgrgegieaqaaalvvre
Timeline for d6mwic1: