SCOPe 2.07: Domain d6mwic1: 6mwi C:1-159

Lineage for d6mwic1 (6mwi C:1-159)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.0: automated matches [191525] (1 protein)
   not a true family

6. Protein automated matches [190884] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [255904] (9 PDB entries)

8. Domain d6mwic1: 6mwi C:1-159 [376446]
   Other proteins in same PDB: d6mwib2, d6mwic2
   automated match to d2pmpa_
   complexed with act, dms, ezl, peg, zn

Details for d6mwic1

PDB Entry: 6mwi, 1.75 Å

PDB Description: crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) burkholderia pseudomallei in complex with ligand hgn- 0456

PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d6mwic1:

Sequence, based on SEQRES records:

>d6mwic1 d.79.5.0 (C:1-159) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

Sequence, based on observed residues (ATOM records):

>d6mwic1 d.79.5.0 (C:1-159) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhftdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadl
dlpldrvnvkaktneklgylgrgegieaqaaalvvre

Timeline for d6mwic1:

• d6mwic1 is new in SCOPe 2.07-stable
  
• d6mwic1 appears in the current release, SCOPe 2.08