SCOP 1.69: Domain d1fmad_: 1fma D:

Lineage for d1fmad_ (1fma D:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (2 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.1: MoaD [54286] (2 proteins)

6. Protein Molybdopterin synthase subunit MoaD [54287] (2 species)

7. Species Escherichia coli [TaxId:562] [54288] (6 PDB entries)

8. Domain d1fmad_: 1fma D: [37643]
   Other proteins in same PDB: d1fmae_
   complexed with MoaE

Details for d1fmad_

PDB Entry: 1fma, 1.58 Å

PDB Description: molybdopterin synthase (moad/moae)

SCOP Domain Sequences for d1fmad_:

Sequence; same for both SEQRES and ATOM records:

>d1fmad_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg

Timeline for d1fmad_:

• d1fmad_ first appeared (with stable ids) in SCOP 1.55
  
• d1fmad_ appears in SCOP 1.67
  
• d1fmad_ appears in SCOP 1.71
  
• d1fmad_ appears in the current release, SCOPe 2.08