SCOP 1.69: Domain d1fmae_: 1fma E:

Lineage for d1fmae_ (1fma E:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (1 family)

5. Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)

6. Protein Molybdopterin synthase subunit MoaE [54692] (1 species)

7. Species Escherichia coli [TaxId:562] [54693] (4 PDB entries)

8. Domain d1fmae_: 1fma E: [38630]
   Other proteins in same PDB: d1fmad_
   complexed with MoaD

Details for d1fmae_

PDB Entry: 1fma, 1.58 Å

PDB Description: molybdopterin synthase (moad/moae)

SCOP Domain Sequences for d1fmae_:

Sequence, based on SEQRES records:

>d1fmae_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records):

>d1fmae_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

Timeline for d1fmae_:

• d1fmae_ first appeared (with stable ids) in SCOP 1.55
  
• d1fmae_ appears in SCOP 1.67
  
• d1fmae_ appears in SCOP 1.71
  
• d1fmae_ appears in the current release, SCOPe 2.08