Lineage for d1fmad_ (1fma D:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.3: MoaD/ThiS [54285] (2 families) 
Family d.15.3.1: Molybdopterin synthase subunit MoaD [54286] (1 protein) Protein Molybdopterin synthase subunit MoaD [54287] (1 species) Species Escherichia coli [TaxId:562] [54288] (2 PDB entries) 
Domain d1fmad_: 1fma D: [37643]
Other proteins in same PDB: d1fmae_
Details for d1fmad_
PDB Entry: 1fma (more details), 1.58 Å
PDB Description: molybdopterin synthase (moad/moae)
SCOP Domain Sequences for d1fmad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmad_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg
SCOP Domain Coordinates for d1fmad_:
Click to download the PDB-style file with coordinates for d1fmad_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fmad_:
- d1fmad_ appears in SCOP 1.57
- d1fmad_ appears in the current release, SCOPe 2.08
View in 3D
