| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.3: MoaD/ThiS [54285] (2 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
| Family d.15.3.1: MoaD [54286] (1 protein) |
| Protein Molybdopterin synthase subunit MoaD [54287] (1 species) |
| Species Escherichia coli [TaxId:562] [54288] (5 PDB entries) |
| Domain d1fm0d_: 1fm0 D: [37642] Other proteins in same PDB: d1fm0e_ complexed with MoaE complexed with cl |
PDB Entry: 1fm0 (more details), 1.45 Å
SCOP Domain Sequences for d1fm0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg
Timeline for d1fm0d_: