Lineage for d6jb8a_ (6jb8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742125Domain d6jb8a_: 6jb8 A: [376356]
    Other proteins in same PDB: d6jb8b_
    automated match to d4y5vd_
    complexed with cl, gol, na, no3

Details for d6jb8a_

PDB Entry: 6jb8 (more details), 1.65 Å

PDB Description: crystal structure of nanobody d3-l11 in complex with hen egg-white lysozyme
PDB Compounds: (A:) Nanobody D3-L11

SCOPe Domain Sequences for d6jb8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jb8a_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscaasgstdsieymtwfrqapgkaregvaalythtgntyyt
dsvkgrftisqdkaknmaylrmdsvksedtaiytcgatrkyvpvrfaldqssydywgqgt
qvtvs

SCOPe Domain Coordinates for d6jb8a_:

Click to download the PDB-style file with coordinates for d6jb8a_.
(The format of our PDB-style files is described here.)

Timeline for d6jb8a_: