SCOP 1.61: Domain d1e3pa4: 1e3p A:346-482

Lineage for d1e3pa4 (1e3p A:346-482)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families)

5. Family d.14.1.4: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54229] (1 protein)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)

7. Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)

8. Domain d1e3pa4: 1e3p A:346-482 [37575]
   Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa5, d1e3pa6, d1e3pa7

Details for d1e3pa4

PDB Entry: 1e3p, 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3pa4:

Sequence; same for both SEQRES and ATOM records:

>d1e3pa4 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus}
tdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnyn
fppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngstsmg
svcastmsllnagvplk

Timeline for d1e3pa4:

• d1e3pa4 first appeared (with stable ids) in SCOP 1.55
  
• d1e3pa4 appears in SCOP 1.59
  
• d1e3pa4 appears in SCOP 1.63
  
• d1e3pa4 appears in the current release, SCOPe 2.08