Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species) duplication of two-domain units formed by domains 1-2 and 4-5 |
Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries) |
Domain d1e3pa4: 1e3p A:346-482 [37575] Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa5, d1e3pa6, d1e3pa7 complexed with so4, wo4 |
PDB Entry: 1e3p (more details), 2.5 Å
SCOPe Domain Sequences for d1e3pa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3pa4 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} tdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnyn fppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngstsmg svcastmsllnagvplk
Timeline for d1e3pa4: