Lineage for d6jlmu_ (6jlm u:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329766Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2329793Protein automated matches [191005] (3 species)
    not a true protein
  7. 2329803Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (5 PDB entries)
  8. 2329808Domain d6jlmu_: 6jlm u: [375562]
    Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmv_, d6jlmx_, d6jlmz_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlmu_

PDB Entry: 6jlm (more details), 2.35 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset2)
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d6jlmu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlmu_ a.60.12.2 (u:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d6jlmu_:

Click to download the PDB-style file with coordinates for d6jlmu_.
(The format of our PDB-style files is described here.)

Timeline for d6jlmu_: