SCOPe 2.07: Domain d6jlml_: 6jlm L:

Lineage for d6jlml_ (6jlm L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)

8. Domain d6jlml_: 6jlm L: [375496]
   Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_
   automated match to d5tisl_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlml_

PDB Entry: 6jlm, 2.35 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset2)

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d6jlml_:

Sequence; same for both SEQRES and ATOM records:

>d6jlml_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d6jlml_:

• d6jlml_ is new in SCOPe 2.07-stable
  
• d6jlml_ appears in the current release, SCOPe 2.08