SCOPe 2.07: Domain d6jpmb_: 6jpm B:

Lineage for d6jpmb_ (6jpm B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (10 species)
   not a true protein

7. Species Chrysopa pallens [TaxId:417485] [375522] (1 PDB entry)

8. Domain d6jpmb_: 6jpm B: [375548]
   automated match to d3r72a_

Details for d6jpmb_

PDB Entry: 6jpm, 2.1 Å

PDB Description: crystal structure of odorant binding protein 4 in the natural predator chrysopa pallens

PDB Compounds: (B:) Odorant binding protein 4

SCOPe Domain Sequences for d6jpmb_:

Sequence; same for both SEQRES and ATOM records:

>d6jpmb_ a.39.2.0 (B:) automated matches {Chrysopa pallens [TaxId: 417485]}
mlteaqmastanlmrkmcqpktkvtdeqinnfhkgvfdddkkmmcymnciletmkiikng
kldmsaveqqmptlpkkyqestkksieecksadtgdkcepaynfakclylsnpemyflp

Timeline for d6jpmb_:

• d6jpmb_ is new in SCOPe 2.07-stable
  
• d6jpmb_ appears in the current release, SCOPe 2.08