Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.0: automated matches [191595] (1 protein) not a true family |
Protein automated matches [191085] (10 species) not a true protein |
Species Honeybee (Apis mellifera) [TaxId:7460] [233420] (1 PDB entry) |
Domain d3r72a_: 3r72 A: [233421] automated match to d3v2la_ complexed with nbb |
PDB Entry: 3r72 (more details), 1.15 Å
SCOPe Domain Sequences for d3r72a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r72a_ a.39.2.0 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]} msmsadqveklaknmrksclqkiaiteelvdgmrrgefpddhdlqcyttcimkllrtfkn gnfdfdmivkqleitmppeevvigkeivavcrneeytgddcqktyqyvqchykqnpekff fp
Timeline for d3r72a_: