Lineage for d3r72a_ (3r72 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711930Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2711931Protein automated matches [191085] (10 species)
    not a true protein
  7. 2711971Species Honeybee (Apis mellifera) [TaxId:7460] [233420] (1 PDB entry)
  8. 2711972Domain d3r72a_: 3r72 A: [233421]
    automated match to d3v2la_
    complexed with nbb

Details for d3r72a_

PDB Entry: 3r72 (more details), 1.15 Å

PDB Description: apis mellifera odorant binding protein 5
PDB Compounds: (A:) Odorant binding protein ASP5

SCOPe Domain Sequences for d3r72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r72a_ a.39.2.0 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]}
msmsadqveklaknmrksclqkiaiteelvdgmrrgefpddhdlqcyttcimkllrtfkn
gnfdfdmivkqleitmppeevvigkeivavcrneeytgddcqktyqyvqchykqnpekff
fp

SCOPe Domain Coordinates for d3r72a_:

Click to download the PDB-style file with coordinates for d3r72a_.
(The format of our PDB-style files is described here.)

Timeline for d3r72a_: