PDB entry 3r72

View 3r72 on RCSB PDB site
Description: Apis mellifera odorant binding protein 5
Class: transport protein
Keywords: helical protein, odorant molecules, antennae, TRANSPORT PROTEIN
Deposited on 2011-03-22, released 2012-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Odorant binding protein ASP5
  Species: Apis mellifera [TaxId:7460]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WRW2 (1-121)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d3r72a_
• Heterogens: NBB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3r72A (A:)
  msmsadqveklaknmrksclqkiaiteelvdgmrrgefpddhdlqcyttcimkllrtfkn
  gnfdfdmivkqleitmppeevvigkeivavcrneeytgddcqktyqyvqchykqnpekff
  fp