Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1efga3 (1efg A:477-599)

  1. Root: SCOP 1.75B
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. Family d.14.1.1: Translational machinery components [54212] (4 protein domains)
  6. Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. Species Thermus thermophilus [TaxId:274] [54214] (9 PDB entries)
  8. Domain d1efga3: 1efg A:477-599 [37550]
    Other proteins in same PDB: d1efga1, d1efga2, d1efga4
    complexed with gdp

Details for d1efga3

PDB Entry: 1efg (more details)
PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d1efga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efga3 d.14.1.1 (A:477-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]}
gkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipk
eyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqk
gdp

SCOP Domain Coordinates for d1efga3:

Click to download the PDB-style file with coordinates for d1efga3.
(The format of our PDB-style files is described here.)

Timeline for d1efga3:

d1efga3 appears in SCOP 1.75A


d1efga3
(click for larger image)


d1efga3 in context of chain
Domains from same chain:
d1efga1, d1efga2, d1efga4


d1efga3 in context of PDB

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu