Lineage for d1efga3 (1efg A:477-599)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930091Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. 2930092Species Thermus thermophilus [TaxId:274] [54214] (9 PDB entries)
  8. 2930100Domain d1efga3: 1efg A:477-599 [37550]
    Other proteins in same PDB: d1efga1, d1efga2, d1efga4
    complexed with gdp

Details for d1efga3

PDB Entry: 1efg (more details), 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1efga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efga3 d.14.1.1 (A:477-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]}
gkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipk
eyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqk
gdp

SCOPe Domain Coordinates for d1efga3:

Click to download the PDB-style file with coordinates for d1efga3.
(The format of our PDB-style files is described here.)

Timeline for d1efga3: