PDB entry 1efg

View 1efg on RCSB PDB site
Description: the crystal structure of elongation factor g complexed with GDP, at 2.7 angstroms resolution
Class: elongation factor
Keywords: elongation factor
Deposited on 1994-10-17, released 1995-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.267
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13551 (0-End)
      • conflict (207)
    Domains in SCOPe 2.07: d1efga1, d1efga2, d1efga3, d1efga4
  • Chain 'B':
    Compound: Elongation factor G
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EFG (0-35)
  • Chain 'C':
    Compound: Elongation factor G
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EFG (0-27)
  • Heterogens: GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efgA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efgA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihktaavttcfwkdhriniidt
    pghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktga
    dlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipee
    yldnareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsal
    knkgvqllldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgr
    ltfirvysgtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketi
    tgdtlvgedaprvilesiegkpqvayretitkpvdvegkfirqtggrgqyghvkikvepl
    prgsgfefvnaivggvipkeyipavqkgieeamqsgpligfpvvdikvtlydgsyhevds
    semafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvigdlnarrgqilgmepr
    gnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqeklik
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.