Lineage for d1kpaa_ (1kpa A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253802Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 253803Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 253804Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
    topologically similar to the N-terminal domain of protein kinases
  6. 253825Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 253826Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 253832Domain d1kpaa_: 1kpa A: [37512]

Details for d1kpaa_

PDB Entry: 1kpa (more details), 2 Å

PDB Description: pkci-1-zinc

SCOP Domain Sequences for d1kpaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpaa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOP Domain Coordinates for d1kpaa_:

Click to download the PDB-style file with coordinates for d1kpaa_.
(The format of our PDB-style files is described here.)

Timeline for d1kpaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kpab_