![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.13: HIT-like [54196] (1 superfamily) |
![]() | Superfamily d.13.1: HIT-like [54197] (2 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins) |
![]() | Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries) |
![]() | Domain d1kpaa_: 1kpa A: [37512] |
PDB Entry: 1kpa (more details), 2 Å
SCOP Domain Sequences for d1kpaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpaa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)} ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d1kpaa_: