PDB entry 1kpa

View 1kpa on RCSB PDB site
Description: pkci-1-zinc
Deposited on 1996-01-06, released 1996-07-11
The last revision prior to the SCOP 1.59 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kpaa_
  • Chain 'B':
    Domains in SCOP 1.59: d1kpab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpaA (A:)
    ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
    lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpaB (B:)
    ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
    lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg