SCOP 1.59: Domain d1kpbb_: 1kpb B:

Lineage for d1kpbb_ (1kpb B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.13: HIT-like [54196] (1 superfamily)

4. Superfamily d.13.1: HIT-like [54197] (2 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)

6. Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)

8. Domain d1kpbb_: 1kpb B: [37511]

Details for d1kpbb_

PDB Entry: 1kpb, 2 Å

PDB Description: pkci-1-apo

SCOP Domain Sequences for d1kpbb_:

Sequence; same for both SEQRES and ATOM records:

>d1kpbb_ d.13.1.1 (B:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d1kpbb_:

• d1kpbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1kpbb_ appears in SCOP 1.57
  
• d1kpbb_ appears in SCOP 1.61
  
• d1kpbb_ appears in the current release, SCOPe 2.08