Lineage for d1kpbb_ (1kpb B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30255Fold d.13: HIT-like [54196] (1 superfamily)
  4. 30256Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 30257Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
  6. 30278Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 30279Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 30284Domain d1kpbb_: 1kpb B: [37511]

Details for d1kpbb_

PDB Entry: 1kpb (more details), 2 Å

PDB Description: pkci-1-apo

SCOP Domain Sequences for d1kpbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpbb_ d.13.1.1 (B:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOP Domain Coordinates for d1kpbb_:

Click to download the PDB-style file with coordinates for d1kpbb_.
(The format of our PDB-style files is described here.)

Timeline for d1kpbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kpba_