Lineage for d1kpbb_ (1kpb B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.13: HIT-like [54196] (1 superfamily) Superfamily d.13.1: HIT-like [54197] (2 families) 
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins) Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries) 
Domain d1kpbb_: 1kpb B: [37511]
Details for d1kpbb_
PDB Entry: 1kpb (more details), 2 Å
PDB Description: pkci-1-apo
SCOP Domain Sequences for d1kpbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpbb_ d.13.1.1 (B:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
SCOP Domain Coordinates for d1kpbb_:
Click to download the PDB-style file with coordinates for d1kpbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kpbb_:
- d1kpbb_ appears in SCOP 1.57
- d1kpbb_ appears in the current release, SCOPe 2.08
View in 3D
