SCOP 1.59: Domain d1kpeb_: 1kpe B:

Lineage for d1kpeb_ (1kpe B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.13: HIT-like [54196] (1 superfamily)

4. Superfamily d.13.1: HIT-like [54197] (2 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)

6. Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)

8. Domain d1kpeb_: 1kpe B: [37509]

Details for d1kpeb_

PDB Entry: 1kpe, 1.8 Å

PDB Description: pkci-transition state analog

SCOP Domain Sequences for d1kpeb_:

Sequence; same for both SEQRES and ATOM records:

>d1kpeb_ d.13.1.1 (B:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d1kpeb_:

• d1kpeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1kpeb_ appears in SCOP 1.57
  
• d1kpeb_ appears in SCOP 1.61
  
• d1kpeb_ appears in the current release, SCOPe 2.08