PDB entry 1kpe

View 1kpe on RCSB PDB site
Description: pkci-transition state analog
Deposited on 1997-09-25, released 1998-03-25
The last revision prior to the SCOP 1.59 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kpea_
  • Chain 'B':
    Domains in SCOP 1.59: d1kpeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kpeA (A:)
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kpeB (B:)
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg