Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Ralstonia sp. [TaxId:54061] [374957] (2 PDB entries) |
Domain d6ihic_: 6ihi C: [374975] automated match to d3f9ia_ complexed with a6o, nap |
PDB Entry: 6ihi (more details), 1.78 Å
SCOPe Domain Sequences for d6ihic_:
Sequence, based on SEQRES records: (download)
>d6ihic_ c.2.1.0 (C:) automated matches {Ralstonia sp. [TaxId: 54061]} myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad vtkledldrlyaivreqrgsidvlfansgaveqktleeitpehydrtfdvnvrgliftvq kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp gaidtpslenqvstqeeadelrakaaaatplgrvgrpeelaaavlflasddssyvagiel fvdggltqv
>d6ihic_ c.2.1.0 (C:) automated matches {Ralstonia sp. [TaxId: 54061]} myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad vtkledldrlyaivreqrgsidvlfansgaveqktleeitpehydrtfdvnvrgliftvq kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp gaidtpsldelrakaaaatplgrvgrpeelaaavlflasddssyvagielfvdggltqv
Timeline for d6ihic_: