Lineage for d6ihic_ (6ihi C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848309Species Ralstonia sp. [TaxId:54061] [374957] (2 PDB entries)
  8. 2848312Domain d6ihic_: 6ihi C: [374975]
    automated match to d3f9ia_
    complexed with a6o, nap

Details for d6ihic_

PDB Entry: 6ihi (more details), 1.78 Å

PDB Description: crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o
PDB Compounds: (C:) Alclohol dehydrogenase

SCOPe Domain Sequences for d6ihic_:

Sequence, based on SEQRES records: (download)

>d6ihic_ c.2.1.0 (C:) automated matches {Ralstonia sp. [TaxId: 54061]}
myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad
vtkledldrlyaivreqrgsidvlfansgaveqktleeitpehydrtfdvnvrgliftvq
kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp
gaidtpslenqvstqeeadelrakaaaatplgrvgrpeelaaavlflasddssyvagiel
fvdggltqv

Sequence, based on observed residues (ATOM records): (download)

>d6ihic_ c.2.1.0 (C:) automated matches {Ralstonia sp. [TaxId: 54061]}
myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad
vtkledldrlyaivreqrgsidvlfansgaveqktleeitpehydrtfdvnvrgliftvq
kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp
gaidtpsldelrakaaaatplgrvgrpeelaaavlflasddssyvagielfvdggltqv

SCOPe Domain Coordinates for d6ihic_:

Click to download the PDB-style file with coordinates for d6ihic_.
(The format of our PDB-style files is described here.)

Timeline for d6ihic_: