Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Ureaplasma urealyticum [TaxId:519849] [374759] (5 PDB entries) |
Domain d6rk7h3: 6rk7 H:225-376 [374791] Other proteins in same PDB: d6rk7a4, d6rk7g4 automated match to d5h9ua3 complexed with cl, sam |
PDB Entry: 6rk7 (more details), 1.8 Å
SCOPe Domain Sequences for d6rk7h3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rk7h3 d.130.1.0 (H:225-376) automated matches {Ureaplasma urealyticum [TaxId: 519849]} iggpigdtgltgrkiivdtyggvghhgggafsgkdptkvdrsasyfarwiaknvvaakla kqceiqlafaigqpqpvamyvntfntnlidetkifeaikksfnfdiktfindlnlwttky lpvatyghfgrddldlsweklnkvedliknsk
Timeline for d6rk7h3: