Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins) |
Protein DNA-binding protein [54162] (2 species) |
Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries) Uniprot P61991 |
Domain d1bf4a_: 1bf4 A: [37461] protein/DNA complex |
PDB Entry: 1bf4 (more details), 1.6 Å
SCOPe Domain Sequences for d1bf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf4a_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]} atvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek qkk
Timeline for d1bf4a_: