Lineage for d1bf4a_ (1bf4 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. Family d.9.2.1: "Histone-like" proteins from arhaea [54161] (1 protein)
  6. Protein DNA-binding protein [54162] (2 species)
  7. Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (5 PDB entries)
  8. Domain d1bf4a_: 1bf4 A: [37461]

Details for d1bf4a_

PDB Entry: 1bf4 (more details), 1.6 Å

PDB Description: chromosomal dna-binding protein sso7d/d(gcgaacgc) complex

SCOP Domain Sequences for d1bf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf4a_ d.9.2.1 (A:) DNA-binding protein {Sulfolobus solfataricus, Sso7d}
atvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

SCOP Domain Coordinates for d1bf4a_ are not available.

Timeline for d1bf4a_: