SCOP 1.75: Domain d1b2ta_: 1b2t A:

Lineage for d1b2ta_ (1b2t A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)

6. Protein Chemokine domain of fractalkine [54146] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54147] (2 PDB entries)

8. Domain d1b2ta_: 1b2t A: [37440]

Details for d1b2ta_

PDB Entry: 1b2t

PDB Description: solution structure of the cx3c chemokine domain of fractalkine

PDB Compounds: (A:) protein (fractalkine)

SCOP Domain Sequences for d1b2ta_:

Sequence; same for both SEQRES and ATOM records:

>d1b2ta_ d.9.1.1 (A:) Chemokine domain of fractalkine {Human (Homo sapiens) [TaxId: 9606]}
mqhhgvtkcnitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvk
damqhldrqaaaltrng

Timeline for d1b2ta_:

• d1b2ta_ first appeared (with stable ids) in SCOP 1.55
  
• d1b2ta_ appears in SCOP 1.73
  
• d1b2ta_ appears in SCOPe 2.01
  
• d1b2ta_ appears in the current release, SCOPe 2.08, called d1b2ta1