Lineage for d1b2ta_ (1b2t A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30042Protein Chemokine domain of fractalkine [54146] (1 species)
  7. 30043Species Human (Homo sapiens) [TaxId:9606] [54147] (2 PDB entries)
  8. 30048Domain d1b2ta_: 1b2t A: [37440]

Details for d1b2ta_

PDB Entry: 1b2t (more details)

PDB Description: solution structure of the cx3c chemokine domain of fractalkine

SCOP Domain Sequences for d1b2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2ta_ d.9.1.1 (A:) Chemokine domain of fractalkine {Human (Homo sapiens)}
mqhhgvtkcnitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvk
damqhldrqaaaltrng

SCOP Domain Coordinates for d1b2ta_:

Click to download the PDB-style file with coordinates for d1b2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1b2ta_: