PDB entry 1b2t

View 1b2t on RCSB PDB site
Description: solution structure of the cx3c chemokine domain of fractalkine
Class: chemokine
Keywords: chemokine
Deposited on 1998-12-01, released 1999-02-23
The last revision prior to the SCOP 1.75 freeze date was dated 2001-04-18, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fractalkine)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78423 (1-76)
      • cloning artifact (0)
    Domains in SCOP 1.75: d1b2ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2tA (A:)
    mqhhgvtkcnitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvk
    damqhldrqaaaltrng