Lineage for d1esra_ (1esr A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536144Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2536302Protein Monocyte chemoattractant protein-2 (MCP-2) [54136] (1 species)
  7. 2536303Species Human (Homo sapiens) [TaxId:9606] [54137] (1 PDB entry)
  8. 2536304Domain d1esra_: 1esr A: [37427]

Details for d1esra_

PDB Entry: 1esr (more details), 2 Å

PDB Description: crystal structure of human monocyte chemotactic protein-2
PDB Compounds: (A:) monocyte chemotactic protein 2

SCOPe Domain Sequences for d1esra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esra_ d.9.1.1 (A:) Monocyte chemoattractant protein-2 (MCP-2) {Human (Homo sapiens) [TaxId: 9606]}
epdsvsipitccfnvinrkipiqrlesytritniqcpkeavifktqrgkevcadpkerwv
rdsmkhldqifqnlkp

SCOPe Domain Coordinates for d1esra_:

Click to download the PDB-style file with coordinates for d1esra_.
(The format of our PDB-style files is described here.)

Timeline for d1esra_: