Lineage for d1esra_ (1esr A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins) 
Protein Monocyte chemoattractant protein-2 (MCP-2) [54136] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54137] (1 PDB entry) 
Domain d1esra_: 1esr A: [37427]
Details for d1esra_
PDB Entry: 1esr (more details), 2 Å
PDB Description: crystal structure of human monocyte chemotactic protein-2
SCOP Domain Sequences for d1esra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esra_ d.9.1.1 (A:) Monocyte chemoattractant protein-2 (MCP-2) {Human (Homo sapiens)}
epdsvsipitccfnvinrkipiqrlesytritniqcpkeavifktqrgkevcadpkerwv
rdsmkhldqifqnlkp
SCOP Domain Coordinates for d1esra_:
Click to download the PDB-style file with coordinates for d1esra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1esra_:
- d1esra_ appears in SCOP 1.57
- d1esra_ appears in the current release, SCOPe 2.08
View in 3D