SCOP 1.61: Domain d1hrjb_: 1hrj B:

Lineage for d1hrjb_ (1hrj B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries)

8. Domain d1hrjb_: 1hrj B: [37419]

Details for d1hrjb_

PDB Entry: 1hrj

PDB Description: human rantes, nmr, 13 structures

SCOP Domain Sequences for d1hrjb_:

Sequence; same for both SEQRES and ATOM records:

>d1hrjb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslems

Timeline for d1hrjb_:

• d1hrjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hrjb_ appears in SCOP 1.59
  
• d1hrjb_ appears in SCOP 1.63
  
• d1hrjb_ appears in the current release, SCOPe 2.08