![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins) |
![]() | Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries) |
![]() | Domain d1hrjb_: 1hrj B: [37419] |
PDB Entry: 1hrj (more details)
SCOP Domain Sequences for d1hrjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hrjb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)} spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre yinslems
Timeline for d1hrjb_: