Lineage for d1eqtb_ (1eqt B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130488Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 130489Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 130490Family d.9.1.1: Interleukin 8-like chemokines [54118] (21 proteins)
  6. 130627Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
  7. 130628Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries)
  8. 130632Domain d1eqtb_: 1eqt B: [37413]

Details for d1eqtb_

PDB Entry: 1eqt (more details), 1.6 Å

PDB Description: met-rantes

SCOP Domain Sequences for d1eqtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqtb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
gyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

SCOP Domain Coordinates for d1eqtb_:

Click to download the PDB-style file with coordinates for d1eqtb_.
(The format of our PDB-style files is described here.)

Timeline for d1eqtb_: