PDB entry 1eqt

View 1eqt on RCSB PDB site
Description: met-rantes
Deposited on 2000-04-06, released 2000-04-19
The last revision prior to the SCOP 1.59 freeze date was dated 2000-04-19, with a file datestamp of 2000-04-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1eqta_
  • Chain 'B':
    Domains in SCOP 1.59: d1eqtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqtA (A:)
    gyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    inslems
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqtB (B:)
    gyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    inslems