SCOPe 2.05: Domain d1b53b_: 1b53 B:

Lineage for d1b53b_ (1b53 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein Macrophage inflammatory protein, MIP [54128] (5 species)
   has different dimerisation mode

7. Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (3 PDB entries)

8. Domain d1b53b_: 1b53 B: [37404]

Details for d1b53b_

PDB Entry: 1b53

PDB Description: nmr structure of human mip-1a d26a, minimized average structure

PDB Compounds: (B:) mip-1a

SCOPe Domain Sequences for d1b53b_:

Sequence; same for both SEQRES and ATOM records:

>d1b53b_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]}
slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlelsa

Timeline for d1b53b_:

• d1b53b_ first appeared (with stable ids) in SCOP 1.55
  
• d1b53b_ appears in SCOPe 2.04
  
• d1b53b_ appears in SCOPe 2.06
  
• d1b53b_ appears in the current release, SCOPe 2.08