Lineage for d1b53b_ (1b53 B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins) 
Protein Macrophage inflammatory protein, MIP [54128] (3 species) 
Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (2 PDB entries) 
Domain d1b53b_: 1b53 B: [37404]
Details for d1b53b_
PDB Entry: 1b53 (more details)
PDB Description: nmr structure of human mip-1a d26a, minimized average structure
SCOP Domain Sequences for d1b53b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b53b_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha}
slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlelsa
SCOP Domain Coordinates for d1b53b_:
Click to download the PDB-style file with coordinates for d1b53b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b53b_:
- d1b53b_ appears in SCOP 1.57
- d1b53b_ appears in the current release, SCOPe 2.08
View in 3D
