Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (24 PDB entries) |
Domain d6e5bl_: 6e5b L: [373957] Other proteins in same PDB: d6e5ba_, d6e5bb_, d6e5bc_, d6e5bd_, d6e5be_, d6e5bg_, d6e5bh_, d6e5bi_, d6e5bj_, d6e5bk_, d6e5bm_, d6e5bn_, d6e5bo_, d6e5bp_, d6e5bq_, d6e5br_, d6e5bs_, d6e5bu_, d6e5bv_, d6e5bw_, d6e5bx_, d6e5by_ automated match to d1iru1_ complexed with huj, na, scn |
PDB Entry: 6e5b (more details), 2.77 Å
SCOPe Domain Sequences for d6e5bl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e5bl_ d.153.1.4 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi saaerdvytgdalricivtkegireetvslrkd
Timeline for d6e5bl_: