Lineage for d6rgqu_ (6rgq U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2596997Species Human (Homo sapiens) [TaxId:9606] [311422] (14 PDB entries)
  8. 2597061Domain d6rgqu_: 6rgq U: [373852]
    Other proteins in same PDB: d6rgqa_, d6rgqh_, d6rgqi_, d6rgqj_, d6rgqk_, d6rgql_, d6rgqm_, d6rgqv_, d6rgqw_, d6rgqx_, d6rgqy_, d6rgqz_
    automated match to d1irug_

Details for d6rgqu_

PDB Entry: 6rgq (more details), 2.6 Å

PDB Description: human 20s proteasome
PDB Compounds: (U:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6rgqu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rgqu_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
gydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnkr
lfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytly
savrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkemt
crdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk

SCOPe Domain Coordinates for d6rgqu_:

Click to download the PDB-style file with coordinates for d6rgqu_.
(The format of our PDB-style files is described here.)

Timeline for d6rgqu_: