| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
| Family b.1.12.0: automated matches [227279] (1 protein) not a true family |
| Protein automated matches [227090] (1 species) not a true protein |
| Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (12 PDB entries) |
| Domain d6of5c1: 6of5 C:8-120 [373760] Other proteins in same PDB: d6of5a2, d6of5b2, d6of5c2, d6of5d2 automated match to d1kbpa1 complexed with bma, edo, fe, fuc, gol, man, mfj, na, nag, pge, so4, zn |
PDB Entry: 6of5 (more details), 2.3 Å
SCOPe Domain Sequences for d6of5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6of5c1 b.1.12.0 (C:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d6of5c1: