SCOPe 2.07: Domain d6pu0a1: 6pu0 A:1-205

Lineage for d6pu0a1 (6pu0 A:1-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (4 species)
   not a true protein

7. Species Columba livia [TaxId:8932] [373721] (2 PDB entries)

8. Domain d6pu0a1: 6pu0 A:1-205 [373722]
   Other proteins in same PDB: d6pu0a2
   automated match to d4mlpa1
   complexed with edo, fad, gol, peg, pge

Details for d6pu0a1

PDB Entry: 6pu0, 1.9 Å

PDB Description: pigeon cryptochrome4 bound to flavin adenine dinucleotide

PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d6pu0a1:

Sequence; same for both SEQRES and ATOM records:

>d6pu0a1 c.28.1.0 (A:1-205) automated matches {Columba livia [TaxId: 8932]}
mphrtihlfrkglrlhdnptllaalessetiypvyvldrrflasamhigalrwhfllqsl
edlhknlsrlgarllviqgeyesvlrdhvqkwnitqvtldaemepfykemeanirrlgae
lgfevlsrvghslydtkrildlnggsppltykrflhilsqlgdpevpvrnltaedfqrcm
spepglaeryrvpvpadleippqsl

Timeline for d6pu0a1:

• d6pu0a1 is new in SCOPe 2.07-stable
  
• d6pu0a1 appears in the current release, SCOPe 2.08