SCOPe 2.07: Domain d6mcqb1: 6mcq B:33-213

Lineage for d6mcqb1 (6mcq B:33-213)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.7: Mob1/phocein [101152] (2 families)
   common fold is elaborated with additional short helices; contains a zinc-binding site
   automatically mapped to Pfam PF03637

5. Family a.29.7.1: Mob1/phocein [101153] (2 proteins)

6. Protein automated matches [319235] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries)

8. Domain d6mcqb1: 6mcq B:33-213 [373623]
   Other proteins in same PDB: d6mcqb2, d6mcqd2
   automated match to d1pi1a_
   complexed with p6g, peg, pg4, zn

Details for d6mcqb1

PDB Entry: 6mcq, 2.57 Å

PDB Description: l. pneumophila effector kinase legk7 in complex with human mob1a

PDB Compounds: (B:) MOB kinase activator 1A

SCOPe Domain Sequences for d6mcqb1:

Sequence; same for both SEQRES and ATOM records:

>d6mcqb1 a.29.7.1 (B:33-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagpr
yeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktil
krlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklg
s

Timeline for d6mcqb1:

• d6mcqb1 is new in SCOPe 2.07-stable
  
• d6mcqb1 appears in the current release, SCOPe 2.08