Lineage for d6mcqb1 (6mcq B:33-213)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708838Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2708839Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2708845Protein automated matches [319235] (2 species)
    not a true protein
  7. 2708846Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries)
  8. 2708854Domain d6mcqb1: 6mcq B:33-213 [373623]
    Other proteins in same PDB: d6mcqb2, d6mcqd2
    automated match to d1pi1a_
    complexed with p6g, peg, pg4, zn

Details for d6mcqb1

PDB Entry: 6mcq (more details), 2.57 Å

PDB Description: l. pneumophila effector kinase legk7 in complex with human mob1a
PDB Compounds: (B:) MOB kinase activator 1A

SCOPe Domain Sequences for d6mcqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mcqb1 a.29.7.1 (B:33-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagpr
yeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktil
krlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklg
s

SCOPe Domain Coordinates for d6mcqb1:

Click to download the PDB-style file with coordinates for d6mcqb1.
(The format of our PDB-style files is described here.)

Timeline for d6mcqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mcqb2