SCOPe 2.07: Domain d6qnpc1: 6qnp C:3-330

Lineage for d6qnpc1 (6qnp C:3-330)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family)

5. Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)

6. Protein automated matches [227067] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226191] (6 PDB entries)

8. Domain d6qnpc1: 6qnp C:3-330 [373564]
   Other proteins in same PDB: d6qnpa2, d6qnpb2, d6qnpc2, d6qnpd2
   automated match to d3gc3b1

Details for d6qnpc1

PDB Entry: 6qnp, 2.7 Å

PDB Description: clathrin heavy chain n-terminal domain bound to gtse1 lidl motif

PDB Compounds: (C:) Clathrin heavy chain 1

SCOPe Domain Sequences for d6qnpc1:

Sequence; same for both SEQRES and ATOM records:

>d6qnpc1 b.69.6.1 (C:3-330) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve

Timeline for d6qnpc1:

• d6qnpc1 is new in SCOPe 2.07-stable
  
• d6qnpc1 appears in the current release, SCOPe 2.08