SCOPe 2.07: Domain d6qnpb2: 6qnp B:331-363

Lineage for d6qnpb2 (6qnp B:331-363)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)

8. Domain d6qnpb2: 6qnp B:331-363 [373569]
   Other proteins in same PDB: d6qnpa1, d6qnpb1, d6qnpc1, d6qnpd1
   automated match to d1c9ia1

Details for d6qnpb2

PDB Entry: 6qnp, 2.7 Å

PDB Description: clathrin heavy chain n-terminal domain bound to gtse1 lidl motif

PDB Compounds: (B:) Clathrin heavy chain 1

SCOPe Domain Sequences for d6qnpb2:

Sequence; same for both SEQRES and ATOM records:

>d6qnpb2 a.118.1.0 (B:331-363) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeniipyitnvlqnpdlalrmavrnnlagaeel

Timeline for d6qnpb2:

• d6qnpb2 is new in SCOPe 2.07-stable
  
• d6qnpb2 appears in the current release, SCOPe 2.08