Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
Domain d6qnpb2: 6qnp B:331-363 [373569] Other proteins in same PDB: d6qnpa1, d6qnpb1, d6qnpc1, d6qnpd1 automated match to d1c9ia1 |
PDB Entry: 6qnp (more details), 2.7 Å
SCOPe Domain Sequences for d6qnpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qnpb2 a.118.1.0 (B:331-363) automated matches {Human (Homo sapiens) [TaxId: 9606]} eeniipyitnvlqnpdlalrmavrnnlagaeel
Timeline for d6qnpb2: