Lineage for d3ubpa_ (3ubp A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77380Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 77381Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 77382Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 77383Protein Urease, gamma-subunit [54113] (2 species)
  7. 77384Species Bacillus pasteurii [TaxId:1474] [54115] (5 PDB entries)
  8. 77389Domain d3ubpa_: 3ubp A: [37355]
    Other proteins in same PDB: d3ubpb_, d3ubpc1, d3ubpc2

Details for d3ubpa_

PDB Entry: 3ubp (more details), 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease

SCOP Domain Sequences for d3ubpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOP Domain Coordinates for d3ubpa_:

Click to download the PDB-style file with coordinates for d3ubpa_.
(The format of our PDB-style files is described here.)

Timeline for d3ubpa_: